General Information

  • ID:  hor001008
  • Uniprot ID:  P09240
  • Protein name:  Cholecystokinin-12
  • Gene name:  CCK
  • Organism:  Mus musculus (Mouse)
  • Family:  Gastrin/cholecystokinin family
  • Source:  Animal
  • Expression:  Expressed and secreted by discrete enteroendocrine cells that reside as single cells scattered among enterocytes in the mucosa of the small intestine. Released into the blood following ingestion of a meal.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0005515 protein binding; GO:0048018 receptor ligand activity; GO:0051428 peptide hormone receptor binding
  • GO BP:  GO:0001764 neuron migration; GO:0001836 release of cytochrome c from mitochondria; GO:0007205 protein kinase C-activating G protein-coupled receptor signaling pathway; GO:0007409 axonogenesis; GO:0007586 digestion; GO:0007613 memory; GO:0008284 positive regulation of cell population proliferation; GO:0008542 visual learning; GO:0014049 positive regulation of glutamate secretion; GO:0031334 positive regulation of protein-containing complex assembly; GO:0032099 negative regulation of appetite; GO:0038188 cholecystokinin signaling pathway; GO:0042755 eating behavior; GO:0043065 positive regulation of apoptotic process; GO:0050731 positive regulation of peptidyl-tyrosine phosphorylation; GO:0051901 positive regulation of mitochondrial depolarization; GO:0099538 synaptic signaling via neuropeptide; GO:1903999 negative regulation of eating behavior; GO:2000986 negative regulation of behavioral fear response; GO:2000987 positive regulation of behavioral fear response
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030424 axon; GO:0030425 dendrite; GO:0043025 neuronal cell body; GO:0043194 axon initial segment; GO:0043195 terminal bouton; GO:0043203 axon hillock; GO:0043204 perikaryon; GO:0098982 GABA-ergic synapse

Sequence Information

  • Sequence:  ISDRDYMGWMDF
  • Length:  12(92-103)
  • Propeptide:  MKSGVCLCVVMAVLAAGALAQPVVPAEATDPVEQRAQEAPRRQLRAVLRTDGEPRARLGALLARYIQQVRKAPSGRMSVLKNLQSLDPSHRISDRDYMGWMDFGRRSAEDYEYPS
  • Signal peptide:  MKSGVCLCVVMAVLAAGALA
  • Modification:  T6 Sulfotyrosine;T12 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut.Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Cckbr, Cckar
  • Target Unid:   P56481, O08786
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P09240-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001008_AF2.pdbhor001008_ESM.pdb

Physical Information

Mass: 173210 Formula: C68H94N16O21S2
Absent amino acids: ACEHKLNPQTV Common amino acids: D
pI: 3.83 Basic residues: 1
Polar residues: 3 Hydrophobic residues: 3
Hydrophobicity: -60.83 Boman Index: -2875
Half-Life / Aliphatic Index: 20 hour Aliphatic Index: 32.5
Instability Index: 6323.33 Extinction Coefficient cystines: 6990
Absorbance 280nm: 635.45

Literature

  • PubMed ID:  NA
  • Title:  NA